Lineage for d1hzhh3 (1hzh H:236-359)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1761466Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)
  7. 1761467Species Human (Homo sapiens) [TaxId:9606] [88585] (41 PDB entries)
    Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region
  8. 1761505Domain d1hzhh3: 1hzh H:236-359 [61439]
    Other proteins in same PDB: d1hzhh1, d1hzhh2, d1hzhh4, d1hzhk1, d1hzhk2, d1hzhk4, d1hzhl1, d1hzhl2, d1hzhm1, d1hzhm2
    part of intact IgG B12 antibody

Details for d1hzhh3

PDB Entry: 1hzh (more details), 2.7 Å

PDB Description: crystal structure of the intact human igg b12 with broad and potent activity against primary hiv-1 isolates: a template for hiv vaccine design
PDB Compounds: (H:) immunoglobulin heavy chain

SCOPe Domain Sequences for d1hzhh3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hzhh3 b.1.1.2 (H:236-359) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
thtcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgv
evhnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiska

SCOPe Domain Coordinates for d1hzhh3:

Click to download the PDB-style file with coordinates for d1hzhh3.
(The format of our PDB-style files is described here.)

Timeline for d1hzhh3: