Lineage for d1hyea1 (1hye A:1-145)
- Root: SCOPe 2.03
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similarSuperfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) 
Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) 
Protein MJ0490, lactate/malate dehydrogenase [63941] (1 species) Species Methanococcus jannaschii [TaxId:2190] [63942] (2 PDB entries) 
Domain d1hyea1: 1hye A:1-145 [61400]
Other proteins in same PDB: d1hyea2
complexed with nap
Details for d1hyea1
PDB Entry: 1hye (more details), 1.9 Å
PDB Description: crystal structure of the mj0490 gene product, the family of lactate/malate dehydrogenase, dimeric structure
PDB Compounds: (A:) l-lactate/malate dehydrogenaseSCOPe Domain Sequences for d1hyea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Methanococcus jannaschii [TaxId: 2190]}
mkvtiigasgrvgsatalllakepfmkdlvligrehsinkleglrediydalagtrsdan
iyvesdenlriidesdvviitsgvprkegmsrmdlaktnakivgkyakkiaeicdtkifv
itnpvdvmtykalvdskfernqvfg
SCOPe Domain Coordinates for d1hyea1:
Click to download the PDB-style file with coordinates for d1hyea1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hyea1:
- d1hyea1 first appeared in SCOP 1.57
- d1hyea1 appears in SCOPe 2.02
- d1hyea1 appears in SCOPe 2.04
- d1hyea1 appears in the current release, SCOPe 2.08
View in 3D
