Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) |
Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins) Common fold covers whole protein structure |
Protein 2,5-diketo-D-gluconic acid reductase A [51443] (3 species) |
Species Corynebacterium sp. [TaxId:1720] [51444] (3 PDB entries) |
Domain d1hw6a_: 1hw6 A: [61296] complexed with cl, mg |
PDB Entry: 1hw6 (more details), 1.9 Å
SCOPe Domain Sequences for d1hw6a_:
Sequence, based on SEQRES records: (download)
>d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} tvpsivlndgnsipqlgygvfkvppadtqraveealevgyrhidtaaiygneegvgaaia asgiarddlfittklwndrhdgdepaaaiaeslaklaldqvdlylvhwptpaadnyvhaw ekmielraagltrsigvsnhlvphlerivaatgvvpavnqielhpayqqreitdwaaahd vkieswgplgqgkydlfgaepvtaaaaahgktpaqavlrwhlqkgfvvfpksvrrerlee nldvfdfdltdteiaaidamdp
>d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} tvpsivlndgnsipqlgygvfkvppadtqraveealevgyrhidtaaiygneegvgaaia asgiarddlfittklwndepaaaiaeslaklaldqvdlylvhwptpaadnyvhawekmie lraagltrsigvsnhlvphlerivaatgvvpavnqielhpayqqreitdwaaahdvkies wgplgqgkydlfgaepvtaaaaahgktpaqavlrwhlqkgfvvfpksvrrerleenldvf dfdltdteiaaidamdp
Timeline for d1hw6a_: