Lineage for d1hula_ (1hul A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1486907Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 1486908Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 1486997Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)
  6. 1487114Protein Interleukin-5 [47293] (1 species)
    intertwined dimer
  7. 1487115Species Human (Homo sapiens) [TaxId:9606] [47294] (1 PDB entry)
  8. 1487116Domain d1hula_: 1hul A: [16865]

Details for d1hula_

PDB Entry: 1hul (more details), 2.4 Å

PDB Description: a novel dimer configuration revealed by the crystal structure at 2.4 angstroms resolution of human interleukin-5
PDB Compounds: (A:) Interleukin-5

SCOPe Domain Sequences for d1hula_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hula_ a.26.1.2 (A:) Interleukin-5 {Human (Homo sapiens) [TaxId: 9606]}
iptsalvketlallsthrtllianetlripvpvhknhqlcteeifqgigtlesqtvqggt
verlfknlslikkyidgqkkkcgeerrrvnqfldylqeflgvmntewi

SCOPe Domain Coordinates for d1hula_:

Click to download the PDB-style file with coordinates for d1hula_.
(The format of our PDB-style files is described here.)

Timeline for d1hula_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1hulb_