Lineage for d1ht6a1 (1ht6 A:348-404)
- Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds) 
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
folded sheet; greek-keySuperfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) 
this domain is C-terminal to the catalytic beta/alpha barrel domainFamily b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
this domain follows the catalytic beta/alpha barrel domain
Protein Plant alpha-amylase [51040] (2 species)
single beta-sheet; probable result of a decay of the common-foldSpecies Barley (Hordeum vulgare), AMY1 isozyme [TaxId:4513] [89384] (7 PDB entries) 
Domain d1ht6a1: 1ht6 A:348-404 [83629]
Other proteins in same PDB: d1ht6a2
complexed with ca, edo
Details for d1ht6a1
PDB Entry: 1ht6 (more details), 1.5 Å
PDB Description: crystal structure at 1.5a resolution of the barley alpha-amylase isozyme 1
PDB Compounds: (A:) alpha-amylase isozyme 1SCOPe Domain Sequences for d1ht6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ht6a1 b.71.1.1 (A:348-404) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]}
itatsalkilmhegdayvaeidgkvvvkigsrydvgavipagfvtsahgndyavwek
SCOPe Domain Coordinates for d1ht6a1:
Click to download the PDB-style file with coordinates for d1ht6a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ht6a1:
- d1ht6a1 first appeared in SCOP 1.65
- d1ht6a1 appears in SCOPe 2.03
- d1ht6a1 appears in SCOPe 2.05
- d1ht6a1 appears in the current release, SCOPe 2.08
View in 3D
