Lineage for d1hqea1 (1hqe A:430-554)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the restSuperfamily c.55.3: Ribonuclease H-like [53098] (15 families) 
consists of one domain of this fold
Family c.55.3.1: Ribonuclease H [53099] (5 proteins) 
Protein HIV RNase H (Domain of reverse transcriptase) [53105] (3 species) 
Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (104 PDB entries)
Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595
Domain d1hqea1: 1hqe A:430-554 [61130]
Other proteins in same PDB: d1hqea2, d1hqeb_
Details for d1hqea1
PDB Entry: 1hqe (more details), 2.7 Å
PDB Description: human immunodeficiency virus type 1
PDB Compounds: (A:) Pol polyproteinSCOPe Domain Sequences for d1hqea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hqea1 c.55.3.1 (A:430-554) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsa
SCOPe Domain Coordinates for d1hqea1:
Click to download the PDB-style file with coordinates for d1hqea1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hqea1:
- d1hqea1 first appeared in SCOP 1.57
- d1hqea1 appears in SCOPe 2.05
- d1hqea1 appears in SCOPe 2.07
- d1hqea1 appears in the current release, SCOPe 2.08
View in 3D
