Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
Protein Histidine-binding protein [53872] (2 species) |
Domain d1hpbp_: 1hpb P: [35806] CA-atoms only complexed with his |
PDB Entry: 1hpb (more details)
SCOPe Domain Sequences for d1hpbp_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hpbp_ c.94.1.1 (P:) Histidine-binding protein {Salmonella typhimurium [TaxId: 90371]} aipqkirigtdptyapfesknaqgelvgfdidlakelckrintqctfvenpldalipslk akkidaimsslsitekrqqeiaftdklyaadsrlvvaknsdiqptvaslkgkrvgvlqgt tqetfgnehwapkgieivsyqgqdniysdltagridaafqdevaasegflkqpvgkdykf ggpavkdeklfgvgtgmglrkednelrealnkafaemradgtyeklakkyfdfdvygg
Timeline for d1hpbp_: