Lineage for d1hmca_ (1hmc A:)
- Root: SCOPe 2.04
Class a: All alpha proteins [46456] (285 folds) 
Fold a.26: 4-helical cytokines [47265] (1 superfamily)
core: 4 helices; bundle, closed; left-handed twist; 2 crossover connectionsSuperfamily a.26.1: 4-helical cytokines [47266] (4 families) 
there are two different topoisomers of this fold with different entanglements of the two crossover connections
Family a.26.1.2: Short-chain cytokines [47286] (14 proteins) - Protein Macrophage colony-stimulating factor (M-CSF) [47295] (1 species)
forms dimer similar to the Flt3 ligand and SCF dimers - Species Human (Homo sapiens) [TaxId:9606] [47296] (1 PDB entry)
Domain d1hmca_: 1hmc A: [16867]
CA-atoms only
Details for d1hmca_
PDB Entry: 1hmc (more details), 2.5 Å
PDB Description: three-dimensional structure of dimeric human recombinant macrophage colony stimulating factor
PDB Compounds: (A:) human macrophage colony stimulating factorSCOPe Domain Sequences for d1hmca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hmca_ a.26.1.2 (A:) Macrophage colony-stimulating factor (M-CSF) {Human (Homo sapiens) [TaxId: 9606]}
seycshmigsghlqslqrlidsqmetscqitfefvdqeqlkdpvcylkkafllvqdimed
tmrfrdntpnaiaivqlqelslrlkscftkdyeehdkacvrtfyetplqllekvknvfne
tknlldkdwnifskncnnsfaecssqgh
SCOPe Domain Coordinates for d1hmca_:
Click to download the PDB-style file with coordinates for d1hmca_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hmca_:
- d1hmca_ first appeared (with stable ids) in SCOP 1.55
- d1hmca_ appears in SCOPe 2.03
- d1hmca_ appears in SCOPe 2.05
- d1hmca_ appears in the current release, SCOPe 2.08, called d1hmca1
View in 3D
