Lineage for d1hlaa2 (1hla A:1-181)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1897191Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1897192Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1897193Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1897285Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species)
  7. 1897297Species Human (Homo sapiens), HLA-A2 [TaxId:9606] [54469] (2 PDB entries)
  8. 1897311Domain d1hlaa2: 1hla A:1-181 [38223]
    Other proteins in same PDB: d1hlaa1, d1hlam_
    CA-atoms only

Details for d1hlaa2

PDB Entry: 1hla (more details), 3.5 Å

PDB Description: structure of the human class i histocompatibility antigen, hla-a2
PDB Compounds: (A:) class I histocompatibility antigen (hla-a2) (alpha chain)

SCOPe Domain Sequences for d1hlaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hlaa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOPe Domain Coordinates for d1hlaa2:

Click to download the PDB-style file with coordinates for d1hlaa2.
(The format of our PDB-style files is described here.)

Timeline for d1hlaa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hlaa1
View in 3D
Domains from other chains:
(mouse over for more information)
d1hlam_