| Class b: All beta proteins [48724] (174 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) ![]() |
| Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins) |
| Protein Xylanase II [49979] (18 species) Partial overlap with common fold and the active sites of the other endoglucanases |
| Species Streptomyces sp. s38, xyl1 [TaxId:181109] [69240] (1 PDB entry) |
| Domain d1hixb_: 1hix B: [65840] |
PDB Entry: 1hix (more details), 2 Å
SCOPe Domain Sequences for d1hixb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hixb_ b.29.1.11 (B:) Xylanase II {Streptomyces sp. s38, xyl1 [TaxId: 181109]}
vittnqtgtnngyyysfwtdgggsvsmnlasggsygtswtncgnfvagkgwangarrtvn
ysgsfnpsgnayltlygwtanplveyyivdnwgtyrptgtykgtvtsdggtydvyqttrv
napsvegtktfnqywsvrqskrtggsitagnhfdawarygmplgsfnyymimategyqss
gsssisv
Timeline for d1hixb_: