Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) |
Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins) |
Protein Immunoglobulin light chain-binding domain of protein L [54362] (1 species) |
Species Peptostreptococcus magnus [TaxId:1260] [54363] (12 PDB entries) |
Domain d1heze_: 1hez E: [60991] Other proteins in same PDB: d1heza1, d1heza2, d1hezb1, d1hezb2, d1hezc1, d1hezc2, d1hezd1, d1hezd2 domain X; res. 820-880 complexed with imd |
PDB Entry: 1hez (more details), 2.7 Å
SCOPe Domain Sequences for d1heze_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1heze_ d.15.7.1 (E:) Immunoglobulin light chain-binding domain of protein L {Peptostreptococcus magnus [TaxId: 1260]} evtikvnlifadgkiqtaefkgtfeeataeayryadllakvngeytadledggnhmnikf a
Timeline for d1heze_: