Lineage for d1hdmb1 (1hdm B:88-185)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) 
Protein Class II MHC beta chain, C-terminal domain [88625] (6 species) 
Species Human (Homo sapiens), HLA-DM [TaxId:9606] [88626] (1 PDB entry)
probably orthologous to the mouse H2-DM
Domain d1hdmb1: 1hdm B:88-185 [21584]
Other proteins in same PDB: d1hdma1, d1hdma2, d1hdmb2
Details for d1hdmb1
PDB Entry: 1hdm (more details), 2.5 Å
PDB Description: histocompatibility antigen hla-dm
PDB Compounds: (B:) protein (class II histocompatibility antigen, m beta chain)SCOPe Domain Sequences for d1hdmb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hdmb1 b.1.1.2 (B:88-185) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DM [TaxId: 9606]}
trppsvqvakttpfntrepvmlacyvwgfypaevtitwrkngklvmhssahktaqpngdw
tyqtlshlaltpsygdtytcvvehigapepilrdwtpg
SCOPe Domain Coordinates for d1hdmb1:
Click to download the PDB-style file with coordinates for d1hdmb1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hdmb1:
- d1hdmb1 first appeared (with stable ids) in SCOP 1.55
- d1hdmb1 appears in SCOPe 2.04
- d1hdmb1 appears in SCOPe 2.06
- d1hdmb1 appears in the current release, SCOPe 2.08
View in 3D
