Lineage for d1hd8a1 (1hd8 A:263-356)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.105: Penicillin-binding protein associated domain [69188] (1 superfamily)
sandwich; 6 strands in 2 sheetsSuperfamily b.105.1: Penicillin-binding protein associated domain [69189] (3 families) 
Family b.105.1.1: PBP5 C-terminal domain-like [69190] (2 proteins)
automatically mapped to Pfam PF07943Protein Penicillin-binding protein 5, C-terminal domain [69191] (1 species) Species Escherichia coli [TaxId:562] [69192] (11 PDB entries) 
Domain d1hd8a1: 1hd8 A:263-356 [65803]
Other proteins in same PDB: d1hd8a2
mutant
Details for d1hd8a1
PDB Entry: 1hd8 (more details), 2.3 Å
PDB Description: crystal structure of a deacylation-defective mutant of penicillin-binding protein 5 at 2.3 a resolution
PDB Compounds: (A:) penicillin-binding protein 5SCOPe Domain Sequences for d1hd8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hd8a1 b.105.1.1 (A:263-356) Penicillin-binding protein 5, C-terminal domain {Escherichia coli [TaxId: 562]}
fetvnplkvgkefasepvwfgdsdraslgvdkdvyltiprgrmkdlkasyvlnsselhap
lqknqvvgtinfqldgktieqrplvvlqeipegn
SCOPe Domain Coordinates for d1hd8a1:
Click to download the PDB-style file with coordinates for d1hd8a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hd8a1:
- d1hd8a1 first appeared in SCOP 1.59
- d1hd8a1 appears in SCOPe 2.07
View in 3D
