Lineage for d1hbha_ (1hbh A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1473061Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1473062Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1473136Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1473405Protein Hemoglobin, alpha-chain [46486] (23 species)
  7. 1473476Species Emerald rockcod (Pagothenia bernacchii) [TaxId:40690] [46495] (11 PDB entries)
  8. 1473485Domain d1hbha_: 1hbh A: [15404]
    Other proteins in same PDB: d1hbhb_, d1hbhd_
    complexed with hem

Details for d1hbha_

PDB Entry: 1hbh (more details), 2.2 Å

PDB Description: structure of deoxyhaemoglobin of the antarctic fish pagothenia bernacchii and structural basis of the root effect
PDB Compounds: (A:) hemoglobin (deoxy) (alpha chain)

SCOPe Domain Sequences for d1hbha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hbha_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Emerald rockcod (Pagothenia bernacchii) [TaxId: 40690]}
slsdkdkaavralwskigksadaigndalsrmivvypqtktyfshwpdvtpgsphikahg
kkvmggialavskiddlktglmelseqhayklrvdpanfkilnhcilvvistmfpkeftp
eahvsldkflsgvalalaeryr

SCOPe Domain Coordinates for d1hbha_:

Click to download the PDB-style file with coordinates for d1hbha_.
(The format of our PDB-style files is described here.)

Timeline for d1hbha_: