Lineage for d1ha0a2 (1ha0 A:330-502)
- Root: SCOPe 2.06
Class h: Coiled coil proteins [57942] (7 folds) 
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
core: trimeric coiled coil
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) 
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) 
Protein Influenza hemagglutinin (stalk) [58066] (12 species)
trimerSpecies Influenza A virus, different strains [TaxId:11320] [58067] (127 PDB entries) 
Domain d1ha0a2: 1ha0 A:330-502 [45697]
Other proteins in same PDB: d1ha0a1
complexed with nag
Details for d1ha0a2
PDB Entry: 1ha0 (more details), 2.8 Å
PDB Description: hemagglutinin precursor ha0
PDB Compounds: (A:) protein (hemagglutinin precursor)SCOPe Domain Sequences for d1ha0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ha0a2 h.3.1.1 (A:330-502) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrnealnnrfqi
SCOPe Domain Coordinates for d1ha0a2:
Click to download the PDB-style file with coordinates for d1ha0a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ha0a2:
- d1ha0a2 first appeared (with stable ids) in SCOP 1.55
- d1ha0a2 appears in SCOPe 2.05
- d1ha0a2 appears in SCOPe 2.07
- d1ha0a2 appears in the current release, SCOPe 2.08
View in 3D
