Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Trematode hemoglobin/myoglobin [63438] (1 species) |
Species Paramphistomum epiclitum [TaxId:54403] [63439] (2 PDB entries) |
Domain d1h97a_: 1h97 A: [60812] complexed with hem, so4 |
PDB Entry: 1h97 (more details), 1.17 Å
SCOPe Domain Sequences for d1h97a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h97a_ a.1.1.2 (A:) Trematode hemoglobin/myoglobin {Paramphistomum epiclitum [TaxId: 54403]} tltkheqdillkelgphvdtpahivetglgayhalftahpqyishfsrleghtienvmqs egikhyartlteaivhmlkeisndaevkkiaaqygkdhtsrkvtkdefmsgepiftkyfq nlvkdaegkaavekflkhvfpmmaaei
Timeline for d1h97a_: