Lineage for d1h92a_ (1h92 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2783169Protein p56-lck tyrosine kinase, SH3 domain [50076] (1 species)
  7. 2783170Species Human (Homo sapiens) [TaxId:9606] [50077] (5 PDB entries)
  8. 2783179Domain d1h92a_: 1h92 A: [65741]

Details for d1h92a_

PDB Entry: 1h92 (more details)

PDB Description: sh3 domain of human lck tyrosine kinase
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase LCK

SCOPe Domain Sequences for d1h92a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h92a_ b.34.2.1 (A:) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]}
gsplqdnlvialhsyepshdgdlgfekgeqlrileqsgewwkaqslttgqegfipfnfva
kan

SCOPe Domain Coordinates for d1h92a_:

Click to download the PDB-style file with coordinates for d1h92a_.
(The format of our PDB-style files is described here.)

Timeline for d1h92a_: