Lineage for d1h8na1 (1h8n A:3-109)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) 
Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (213 PDB entries)
Uniprot P01645 1-106 # 95% sequense identity; KV5L_MOUSE Ig kappa chain V-V region HP 93G7 ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! SQ NA # humanized antibody ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01642 21-115 # ! KV5I_MOUSE Ig kappa chain V-V region L7 precursor
Domain d1h8na1: 1h8n A:3-109 [60783]
Other proteins in same PDB: d1h8na2
part of anti-ampicillin scFv
complexed with gol, so4; mutant
Details for d1h8na1
PDB Entry: 1h8n (more details), 1.87 Å
PDB Description: three-dimensional structure of anti-ampicillin single chain fv fragment from phage-displayed murine antibody libraries
PDB Compounds: (A:) mutant al2 6e7s9gSCOPe Domain Sequences for d1h8na1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h8na1 b.1.1.1 (A:3-109) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
kdivltqshkfmstsvgdrvsitckasqdvgtavawyqqkpgqspklliywastrhtgvp
drftgsgsgtdftltisnvqsedladyfcqqyssypltfgagtklel
SCOPe Domain Coordinates for d1h8na1:
Click to download the PDB-style file with coordinates for d1h8na1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1h8na1:
- d1h8na1 first appeared in SCOP 1.57
- d1h8na1 appears in SCOPe 2.04
- d1h8na1 appears in SCOPe 2.06
- d1h8na1 appears in the current release, SCOPe 2.08
View in 3D
