Lineage for d1h8eh_ (1h8e H:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 965281Fold b.93: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51343] (1 superfamily)
    pseudobarrel: sandwich of two sheets packed at a positive interstrand angle and interconnected with many short turns
  4. 965282Superfamily b.93.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51344] (1 family) (S)
  5. 965283Family b.93.1.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51345] (1 protein)
  6. 965284Protein Epsilon subunit of F1F0-ATP synthase N-terminal domain [51346] (2 species)
    delta subunit in mitochondria
  7. 965285Species Cow (Bos taurus) [TaxId:9913] [51348] (5 PDB entries)
  8. 965290Domain d1h8eh_: 1h8e H: [60757]
    Other proteins in same PDB: d1h8ea1, d1h8ea2, d1h8ea3, d1h8eb1, d1h8eb2, d1h8eb3, d1h8ec1, d1h8ec2, d1h8ec3, d1h8ed1, d1h8ed2, d1h8ed3, d1h8ee1, d1h8ee2, d1h8ee3, d1h8ef1, d1h8ef2, d1h8ef3, d1h8eg_, d1h8ei_
    the rest of subunit structure is disordered
    complexed with adp, alf, gol, mg, so4

Details for d1h8eh_

PDB Entry: 1h8e (more details), 2 Å

PDB Description: (adp.alf4)2(adp.so4) bovine f1-atpase (all three catalytic sites occupied)
PDB Compounds: (H:) bovine mitochondrial f1-ATPase

SCOPe Domain Sequences for d1h8eh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h8eh_ b.93.1.1 (H:) Epsilon subunit of F1F0-ATP synthase N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
qmsftfasptqvffnsanvrqvdvptqtgafgilaahvptlqvlrpglvvvhaedgttsk
yfvssgsvtvnadssvqllaeeavtldml

SCOPe Domain Coordinates for d1h8eh_:

Click to download the PDB-style file with coordinates for d1h8eh_.
(The format of our PDB-style files is described here.)

Timeline for d1h8eh_: