| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
| Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
| Protein Mono-heme c-type cytochrome SoxX [81675] (1 species) |
| Species Rhodovulum sulfidophilum [TaxId:35806] [81676] (4 PDB entries) |
| Domain d1h31b_: 1h31 B: [76608] Other proteins in same PDB: d1h31a1, d1h31a2, d1h31c1, d1h31c2, d1h31e1, d1h31e2, d1h31g1, d1h31g2 complexed with hec |
PDB Entry: 1h31 (more details), 2.55 Å
SCOPe Domain Sequences for d1h31b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h31b_ a.3.1.1 (B:) Mono-heme c-type cytochrome SoxX {Rhodovulum sulfidophilum [TaxId: 35806]}
aevapgdvaidgqghvarpltdapgdpvegrrlmtdrsvgnciachevtemadaqfpgtv
gpsldgvaarypeamirgilvnsknvfpetvmpayyrvegfnrpgiaftskpiegeirpl
mtagqiedvvaylmtltq
Timeline for d1h31b_: