Lineage for d1h24a_ (1h24 A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1220003Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1220004Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1220070Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1220363Protein Cyclin-dependent PK, CDK2 [88855] (2 species)
    CMGC group; CDKs subfamily; serine/threonine kinase
  7. 1220364Species Human (Homo sapiens) [TaxId:9606] [88856] (223 PDB entries)
    Uniprot P24941
  8. 1220598Domain d1h24a_: 1h24 A: [76516]
    Other proteins in same PDB: d1h24b1, d1h24b2, d1h24d1, d1h24d2
    complex with cyclin and a 9 residue recruitment peptide from E2F

Details for d1h24a_

PDB Entry: 1h24 (more details), 2.5 Å

PDB Description: cdk2/cyclin a in complex with a 9 residue recruitment peptide from e2f
PDB Compounds: (A:) Cell division protein kinase 2

SCOPe Domain Sequences for d1h24a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h24a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
smenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkeln
hpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafch
shrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgcky
ystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykps
fpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpv

SCOPe Domain Coordinates for d1h24a_:

Click to download the PDB-style file with coordinates for d1h24a_.
(The format of our PDB-style files is described here.)

Timeline for d1h24a_: