Class b: All beta proteins [48724] (174 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins) |
Protein Elastase [50536] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [50537] (5 PDB entries) |
Domain d1h1ba_: 1h1b A: [76466] complexed with 151 |
PDB Entry: 1h1b (more details), 2 Å
SCOPe Domain Sequences for d1h1ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h1ba_ b.47.1.2 (A:) Elastase {Human (Homo sapiens) [TaxId: 9606]} ivggrrarphawpfmvslqlrgghfcgatliapnfvmsaahcvanvnvravrvvlgahnl srreptrqvfavqrifengydpvnllndivilqlngsatinanvqvaqlpaqgrrlgngv qclamgwgllgrnrgiasvlqelnvtvvtslcrrsnvctlvrgrqagvcfgdsgsplvcn glihgiasfvrggcasglypdafapvaqfvnwidsiiq
Timeline for d1h1ba_: