Lineage for d1gx3a_ (1gx3 A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1398964Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1398965Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1399437Family d.3.1.5: Arylamine N-acetyltransferase [54047] (2 proteins)
    fold similar to that of the factor XIII catalytic domain
    automatically mapped to Pfam PF00797
  6. 1399438Protein Arylamine N-acetyltransferase [54048] (4 species)
  7. 1399439Species Mycobacterium smegmatis [TaxId:1772] [75335] (3 PDB entries)
  8. 1399441Domain d1gx3a_: 1gx3 A: [70678]

Details for d1gx3a_

PDB Entry: 1gx3 (more details), 1.7 Å

PDB Description: m. smegmatis arylamine n-acetyl transferase
PDB Compounds: (A:) arylamine n-acetyltransferase

SCOPe Domain Sequences for d1gx3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gx3a_ d.3.1.5 (A:) Arylamine N-acetyltransferase {Mycobacterium smegmatis [TaxId: 1772]}
gmamdlggyltrigldgrprpdlgtlhaivaahnrsipfenldpllgipvadlsaealfa
klvdrrrggycyehngllgyvleelgfeverlsgrvvwmraddaplpaqthnvlsvavpg
adgrylvdvgfggqtltspirleagpvqqtrhepyrltrhgddhtlaaqvrgewqplytf
tteprpridlevgswyvsthpgshfvtgltvavvtddarynlrgrnlavhrsgatehirf
dsaaqvldaivnrfgidlgdlagrdvqarvaevldt

SCOPe Domain Coordinates for d1gx3a_:

Click to download the PDB-style file with coordinates for d1gx3a_.
(The format of our PDB-style files is described here.)

Timeline for d1gx3a_: