Lineage for d1gx3a_ (1gx3 A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. Family d.3.1.5: Arylamine N-acetyltransferase [54047] (2 proteins)
    fold similar to that of the factor XIII catalytic domain
    automatically mapped to Pfam PF00797
  6. Protein Arylamine N-acetyltransferase [54048] (4 species)
  7. Species Mycobacterium smegmatis [TaxId:1772] [75335] (3 PDB entries)
  8. Domain d1gx3a_: 1gx3 A: [70678]

Details for d1gx3a_

PDB Entry: 1gx3 (more details), 1.7 Å

PDB Description: m. smegmatis arylamine n-acetyl transferase
PDB Compounds: (A:) arylamine n-acetyltransferase

SCOPe Domain Sequences for d1gx3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gx3a_ d.3.1.5 (A:) Arylamine N-acetyltransferase {Mycobacterium smegmatis [TaxId: 1772]}
gmamdlggyltrigldgrprpdlgtlhaivaahnrsipfenldpllgipvadlsaealfa
klvdrrrggycyehngllgyvleelgfeverlsgrvvwmraddaplpaqthnvlsvavpg
adgrylvdvgfggqtltspirleagpvqqtrhepyrltrhgddhtlaaqvrgewqplytf
tteprpridlevgswyvsthpgshfvtgltvavvtddarynlrgrnlavhrsgatehirf
dsaaqvldaivnrfgidlgdlagrdvqarvaevldt

SCOPe Domain Coordinates for d1gx3a_ are not available.

Timeline for d1gx3a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1gx3b_, d1gx3c_, d1gx3d_