Lineage for d1gx2a_ (1gx2 A:)
- Root: SCOPe 2.04
Class a: All alpha proteins [46456] (285 folds) 
Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
multihelical; consists of two all-alpha domainsSuperfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) 
Family a.93.1.1: CCP-like [48114] (5 proteins) 
Protein Plant peroxidase [48125] (6 species) Species Horseradish (Armoracia rusticana) [TaxId:3704] [48126] (29 PDB entries) 
Domain d1gx2a_: 1gx2 A: [83360]
complexed with bho, ca, hem
Details for d1gx2a_
PDB Entry: 1gx2 (more details), 2.2 Å
PDB Description: recombinant horseradish peroxidase phe209ser complex with benzhydroxamic acid
PDB Compounds: (A:) peroxidase c1aSCOPe Domain Sequences for d1gx2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gx2a_ a.93.1.1 (A:) Plant peroxidase {Horseradish (Armoracia rusticana) [TaxId: 3704]}
mqltptfydnscpnvsnivrdtivnelrsdpriaasilrlhfhdcfvngcdasilldntt
sfrtekdafgnansargfpvidrmkaavesacprtvscadlltiaaqqsvtlaggpswrv
plgrrdslqafldlananlpapfftlpqlkdsfrnvglnrssdlvalsgghtfgknqcrs
imdrlynfsntglpdptlnttylqtlrglcplngnlsalvdfdlrtptifdnkyyvnlee
qkgliqsdqelfsspnatdtiplvrsfanstqtffnafveamdrmgnitpltgtqgqirl
ncrvvnsns
SCOPe Domain Coordinates for d1gx2a_:
Click to download the PDB-style file with coordinates for d1gx2a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gx2a_:
- d1gx2a_ first appeared in SCOP 1.65
- d1gx2a_ appears in SCOPe 2.03
- d1gx2a_ appears in SCOPe 2.05
- d1gx2a_ appears in the current release, SCOPe 2.08
View in 3D
