Lineage for d1gv3a2 (1gv3 A:127-237)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2189807Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2189808Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2189809Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)
  6. 2189935Protein Mn superoxide dismutase (MnSOD) [54721] (9 species)
  7. 2189936Species Anabaena sp. [TaxId:1167] [75409] (1 PDB entry)
  8. 2189937Domain d1gv3a2: 1gv3 A:127-237 [70586]
    Other proteins in same PDB: d1gv3a1, d1gv3b1
    complexed with mn

Details for d1gv3a2

PDB Entry: 1gv3 (more details), 2 Å

PDB Description: the 2.0 angstrom resolution structure of the catalytic portion of a cyanobacterial membrane-bound manganese superoxide dismutase
PDB Compounds: (A:) manganese superoxide dismutase

SCOPe Domain Sequences for d1gv3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gv3a2 d.44.1.1 (A:127-237) Mn superoxide dismutase (MnSOD) {Anabaena sp. [TaxId: 1167]}
dgggqptgdiaqeinqtfgsfeefkkqfnqaggdrfgsgwvwlvrnpqgqlqvvstpnqd
npimegsypimgndvwehayylryqnrrpeylnnwwnvvnwseinrrtqas

SCOPe Domain Coordinates for d1gv3a2:

Click to download the PDB-style file with coordinates for d1gv3a2.
(The format of our PDB-style files is described here.)

Timeline for d1gv3a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gv3a1