Lineage for d1gssa2 (1gss A:1-76)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876589Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2876959Protein Class pi GST [81358] (4 species)
  7. 2876960Species Human (Homo sapiens) [TaxId:9606] [52864] (64 PDB entries)
  8. 2877101Domain d1gssa2: 1gss A:1-76 [32878]
    Other proteins in same PDB: d1gssa1, d1gssb1
    complexed with lee

Details for d1gssa2

PDB Entry: 1gss (more details), 2.8 Å

PDB Description: three-dimensional structure of class pi glutathione s-transferase from human placenta in complex with s-hexylglutathione at 2.8 angstroms resolution
PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d1gssa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gssa2 c.47.1.5 (A:1-76) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
tlyqsntilrhlgrtlgl

SCOPe Domain Coordinates for d1gssa2:

Click to download the PDB-style file with coordinates for d1gssa2.
(The format of our PDB-style files is described here.)

Timeline for d1gssa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gssa1