Class g: Small proteins [56992] (100 folds) |
Fold g.18: Complement control module/SCR domain [57534] (1 superfamily) disulfide-rich all-beta fold |
Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) |
Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins) Pfam PF00084 |
Protein Complement C1R protease domains [75682] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [75683] (3 PDB entries) |
Domain d1gpza2: 1gpz A:290-357 [70303] Other proteins in same PDB: d1gpza1, d1gpzb1 complexed with nag |
PDB Entry: 1gpz (more details), 2.9 Å
SCOPe Domain Sequences for d1gpza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gpza2 g.18.1.1 (A:290-357) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]} ikcpqpktldeftiiqnlqpqyqfrdyfiatckqgyqliegnqvlhsftavcqddgtwhr amprckik
Timeline for d1gpza2: