Lineage for d1gpca_ (1gpc A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1123681Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1124635Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1125476Family b.40.4.7: Phage ssDNA-binding proteins [50315] (4 proteins)
    barrel, open; n*=5, S*=8; the members' structures vary greater that those from cellular organisms
  6. 1125477Protein Gene 32 protein (gp32) core [50319] (2 species)
    contains a Zn-finger subdomain, res. 63-111
  7. 1125478Species Bacteriophage T4 [TaxId:10665] [50320] (1 PDB entry)
  8. 1125479Domain d1gpca_: 1gpc A: [25393]
    protein/DNA complex; complexed with zn

Details for d1gpca_

PDB Entry: 1gpc (more details), 2.2 Å

PDB Description: core gp32, dna-binding protein
PDB Compounds: (A:) protein (core gp32)

SCOPe Domain Sequences for d1gpca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gpca_ b.40.4.7 (A:) Gene 32 protein (gp32) core {Bacteriophage T4 [TaxId: 10665]}
gfssedkgewklkldnagngqavirflpskndeqapfailvnhgfkkngkwyietcssth
gdydscpvcqyiskndlyntdnkeyslvkrktsywanilvvkdpaapenegkvfkyrfgk
kiwdkinamiavdvemgetpvdvtcpweganfvlkvkqvsgfsnydeskflnqsaipnid
desfqkelfeqmvdlsemtskdkfksfeelntkfgqvm

SCOPe Domain Coordinates for d1gpca_:

Click to download the PDB-style file with coordinates for d1gpca_.
(The format of our PDB-style files is described here.)

Timeline for d1gpca_: