Class b: All beta proteins [48724] (176 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) |
Family b.18.1.1: Galactose-binding domain [49786] (2 proteins) automatically mapped to Pfam PF00754 |
Protein Galactose oxidase, N-terminal domain [49787] (3 species) |
Species Dactylium dendroides [TaxId:5132] [49788] (3 PDB entries) Uniprot Q01745 42-680 |
Domain d1gofa2: 1gof A:1-150 [23709] Other proteins in same PDB: d1gofa1, d1gofa3 complexed with acy, cu, na |
PDB Entry: 1gof (more details), 1.7 Å
SCOPe Domain Sequences for d1gofa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gofa2 b.18.1.1 (A:1-150) Galactose oxidase, N-terminal domain {Dactylium dendroides [TaxId: 5132]} asapigsaisrnnwavtcdsaqsgnecnkaidgnkdtfwhtfygangdpkpphtytidmk ttqnvnglsmlprqdgnqngwigrhevylssdgtnwgspvasgswfadsttkysnfetrp aryvrlvaiteangqpwtsiaeinvfqass
Timeline for d1gofa2: