Lineage for d1gngb_ (1gng B:)
- Root: SCOPe 2.02
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
consists of two alpha+beta domains, C-terminal domain is mostly alpha helicalSuperfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) 
shares functional and structural similarities with the ATP-grasp fold and PIPKFamily d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
members organized in the groups and subfamiles specified by the comments
Protein Glycogen synthase kinase-3 beta (Gsk3b) [69823] (1 species)
CMGC group; GSK3 subfamily; serine/threonine kinaseSpecies Human (Homo sapiens) [TaxId:9606] [69824] (23 PDB entries)
Uniprot P49841 35-383 ! Uniprot P49841 35-384
Domain d1gngb_: 1gng B: [76240]
complexed with so4, trs
Details for d1gngb_
PDB Entry: 1gng (more details), 2.6 Å
PDB Description: glycogen synthase kinase-3 beta (gsk3) complex with frattide peptide
PDB Compounds: (B:) Glycogen synthase kinase-3 betaSCOPe Domain Sequences for d1gngb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gngb_ d.144.1.7 (B:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]}
vsrdkdgskvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkv
lqdkrfknrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhys
rakqtlpviyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakql
vrgepnvsyicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlv
eiikvlgtptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytpta
rltpleacahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphari
SCOPe Domain Coordinates for d1gngb_:
Click to download the PDB-style file with coordinates for d1gngb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gngb_:
- d1gngb_ first appeared in SCOP 1.63
- d1gngb_ appears in SCOPe 2.01
- d1gngb_ appears in SCOPe 2.03
- d1gngb_ appears in the current release, SCOPe 2.08
View in 3D
