Lineage for d1gm1a_ (1gm1 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2056344Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2056345Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2056346Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2056487Protein Phosphatase hPTP1e [50168] (2 species)
  7. 2056501Species Mouse (Mus musculus) [TaxId:10090] [74930] (3 PDB entries)
  8. 2056502Domain d1gm1a_: 1gm1 A: [70271]
    PDZ2 domain

Details for d1gm1a_

PDB Entry: 1gm1 (more details)

PDB Description: second pdz domain (pdz2) of ptp-bl
PDB Compounds: (A:) protein tyrosine phosphatase

SCOPe Domain Sequences for d1gm1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gm1a_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]}
kpgdtfevelaktdgslgisvtggvntsvrhggiyvkaiipkgaaesdgrihkgdrvlav
ngvslegathkqavetlrntgqvvhlllekgqvp

SCOPe Domain Coordinates for d1gm1a_:

Click to download the PDB-style file with coordinates for d1gm1a_.
(The format of our PDB-style files is described here.)

Timeline for d1gm1a_: