Lineage for d1gd6a_ (1gd6 A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1013435Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1013436Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1013457Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
  6. 1013515Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tissues and secretions
  7. 1014090Species Silkworm (Bombyx mori) [TaxId:7091] [64201] (1 PDB entry)
  8. 1014091Domain d1gd6a_: 1gd6 A: [60440]

Details for d1gd6a_

PDB Entry: 1gd6 (more details), 2.5 Å

PDB Description: structure of the bombyx mori lysozyme
PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d1gd6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gd6a_ d.2.1.2 (A:) Lysozyme {Silkworm (Bombyx mori) [TaxId: 7091]}
ktftrcglvhelrkhgfeenlmrnwvclvehessrdtsktntnrngskdyglfqindryw
cskgaspgkdcnvkcsdlltdditkaakcakkiykrhrfdawygwknhcqgslpdissc

SCOPe Domain Coordinates for d1gd6a_:

Click to download the PDB-style file with coordinates for d1gd6a_.
(The format of our PDB-style files is described here.)

Timeline for d1gd6a_: