Lineage for d1gcoa_ (1gco A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1346668Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 1347460Protein Glucose dehydrogenase [51784] (1 species)
  7. 1347461Species Bacillus megaterium [TaxId:1404] [51785] (4 PDB entries)
  8. 1347466Domain d1gcoa_: 1gco A: [29884]
    complexed with nad

Details for d1gcoa_

PDB Entry: 1gco (more details), 1.7 Å

PDB Description: crystal structure of glucose dehydrogenase complexed with nad+
PDB Compounds: (A:) glucose dehydrogenase

SCOPe Domain Sequences for d1gcoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gcoa_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]}
mykdlegkvvvitgsstglgksmairfatekakvvvnyrskedeansvleeikkvggeai
avkgdvtvesdvinlvqsaikefgkldvminnaglenpvsshemslsdwnkvidtnltga
flgsreaikyfvendikgtvinmssvhekipwplfvhyaaskggmklmtetlaleyapkg
irvnnigpgaintpinaekfadpeqradvesmipmgyigepeeiaavaawlasseasyvt
gitlfadggmtqypsfqagrg

SCOPe Domain Coordinates for d1gcoa_:

Click to download the PDB-style file with coordinates for d1gcoa_.
(The format of our PDB-style files is described here.)

Timeline for d1gcoa_: