Lineage for d1g9sa_ (1g9s A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.61: PRTase-like [53270] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the restSuperfamily c.61.1: PRTase-like [53271] (3 families) 
Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins) 
Protein Hypoxanthine PRTase [53286] (4 species) 
Species Escherichia coli [TaxId:562] [75255] (3 PDB entries) 
Domain d1g9sa_: 1g9s A: [70164]
complexed with imp, n
Details for d1g9sa_
PDB Entry: 1g9s (more details), 2.8 Å
PDB Description: crystal structure of a complex between e.coli hprt and imp
PDB Compounds: (A:) hypoxanthine phosphoribosyltransferaseSCOPe Domain Sequences for d1g9sa_:
Sequence, based on SEQRES records: (download)
>d1g9sa_ c.61.1.1 (A:) Hypoxanthine PRTase {Escherichia coli [TaxId: 562]}
mkhtvevmipeaeikariaelgrqiterykdsgsdmvlvgllrgsfmfmadlcrevqvsh
evdfmtassygsgmsttrdlkilkdldedirgkdvlivediidsgntlskvreilslrep
kslaictlldkpsrrevnvpvefigfsipdefvvgygidyaqryrhlpyigkvilld
Sequence, based on observed residues (ATOM records): (download)
>d1g9sa_ c.61.1.1 (A:) Hypoxanthine PRTase {Escherichia coli [TaxId: 562]}
mkhtvevmipeaeikariaelgrqiterykdsgsdmvlvgllrgsfmfmadlcrevqvsh
evdfmtassrdlkilkdldedirgkdvlivediidsgntlskvreilslrepkslaictl
ldkpsrrevnvpvefigfsipdefvvgygidyaqryrhlpyigkvilld
SCOPe Domain Coordinates for d1g9sa_:
Click to download the PDB-style file with coordinates for d1g9sa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1g9sa_:
- d1g9sa_ first appeared in SCOP 1.61
- d1g9sa_ appears in SCOPe 2.07
View in 3D
