SCOPe 2.04: Domain d1g9ml2: 1g9m L:110-214

Lineage for d1g9ml2 (1g9m L:110-214)

Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

Species Human (Homo sapiens) [TaxId:9606] [88569] (144 PDB entries)
including humanized antibodies (chimeric proteins with human constant domains)
SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody

Domain d1g9ml2: 1g9m L:110-214 [21262]
Other proteins in same PDB: d1g9mc1, d1g9mc2, d1g9mg_, d1g9mh1, d1g9mh2, d1g9ml1
part of HIV-1 neutralizing Fab 17B; binds to the CD4-induced state of gp120
complexed with ipa, nag, ndg

Details for d1g9ml2

PDB Entry: 1g9m (more details), 2.2 Å

PDB Description: hiv-1 hxbc2 gp120 envelope glycoprotein complexed with cd4 and induced neutralizing antibody 17b

PDB Compounds: (L:) antibody 17b, light chain

SCOPe Domain Sequences for d1g9ml2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g9ml2 b.1.1.2 (L:110-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqk
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOPe Domain Coordinates for d1g9ml2:

Click to download the PDB-style file with coordinates for d1g9ml2.
(The format of our PDB-style files is described here.)

Timeline for d1g9ml2: