Lineage for d1g6aa_ (1g6a A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3012720Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3013003Protein beta-Lactamase, class A [56606] (16 species)
  7. 3013248Species Pseudomonas aeruginosa, PSE-4 carbenicillinase [TaxId:287] [56610] (2 PDB entries)
  8. 3013249Domain d1g6aa_: 1g6a A: [42704]
    complexed with so4; mutant

Details for d1g6aa_

PDB Entry: 1g6a (more details), 1.75 Å

PDB Description: pse-4 carbenicillinase, r234k mutant
PDB Compounds: (A:) beta-lactamase pse-4

SCOPe Domain Sequences for d1g6aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g6aa_ e.3.1.1 (A:) beta-Lactamase, class A {Pseudomonas aeruginosa, PSE-4 carbenicillinase [TaxId: 287]}
skfqqveqdvkaievslsarigvsvldtqngeywdyngnqrfpltstfktiacakllyda
eqgkvnpnstveikkadlvtyspviekqvgqaitlddacfatmttsdntaaniilsavgg
pkgvtdflrqigdketrldriepdlnegklgdlrdtttpkaiastlnkflfgsalsemnq
kkleswmvnnqvtgnllrsvlpagwniadksgaggfgarsitavvwsehqapiivsiyla
qtqasmeerndaivkighsifdvyts

SCOPe Domain Coordinates for d1g6aa_:

Click to download the PDB-style file with coordinates for d1g6aa_.
(The format of our PDB-style files is described here.)

Timeline for d1g6aa_: