Lineage for d1g5ua_ (1g5u A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970039Superfamily d.110.1: Profilin (actin-binding protein) [55770] (2 families) (S)
    alpha-beta(2)-alpha-beta(5)-alpha
  5. 2970040Family d.110.1.1: Profilin (actin-binding protein) [55771] (2 proteins)
    automatically mapped to Pfam PF00235
  6. 2970041Protein Profilin (actin-binding protein) [55772] (8 species)
  7. 2970076Species Rubber tree (Hevea brasiliensis), hevb8 [TaxId:3981] [55780] (1 PDB entry)
  8. 2970077Domain d1g5ua_: 1g5u A: [40893]
    complexed with na

Details for d1g5ua_

PDB Entry: 1g5u (more details), 3.1 Å

PDB Description: latex profilin hevb8
PDB Compounds: (A:) Profilin

SCOPe Domain Sequences for d1g5ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g5ua_ d.110.1.1 (A:) Profilin (actin-binding protein) {Rubber tree (Hevea brasiliensis), hevb8 [TaxId: 3981]}
swqtyvddhlmcdidghrltaaaiighdgsvwaqsssfpqfksdevaavmkdfdepgsla
ptglhlggtkymviqgepgavirgkkgsggitvkrtgqaliigiydepltpgqcnmiver
lgdylldqgl

SCOPe Domain Coordinates for d1g5ua_:

Click to download the PDB-style file with coordinates for d1g5ua_.
(The format of our PDB-style files is described here.)

Timeline for d1g5ua_: