Lineage for d1g3ma_ (1g3m A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) 
division into families based on beta-sheet topologies
Family c.37.1.5: PAPS sulfotransferase [52575] (15 proteins)
Pfam PF00685
similar to the nucleotide/nucleoside kinases but transfer sulphate group
Protein Estrogen sulfotransferase (STE, sult1e1) [52576] (2 species) 
Species Human (Homo sapiens) [TaxId:9606] [75198] (5 PDB entries) 
Domain d1g3ma_: 1g3m A: [83268]
complexed with a3p, edo, pcq
Details for d1g3ma_
PDB Entry: 1g3m (more details), 1.7 Å
PDB Description: crystal structure of human estrogen sulfotransferase in complex with in-active cofactor pap and 3,5,3',5'-tetrachloro-biphenyl-4,4'-diol
PDB Compounds: (A:) estrogen sulfotransferaseSCOPe Domain Sequences for d1g3ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g3ma_ c.37.1.5 (A:) Estrogen sulfotransferase (STE, sult1e1) {Human (Homo sapiens) [TaxId: 9606]}
seldyyekfeevhgilmykdfvkywdnveafqarpddlviatypksgttwvseivymiyk
egdvekckedvifnripflecrkenlmngvkqldemnsprivkthlppellpasfwekdc
kiiylcrnakdvavsfyyfflmvaghpnpgsfpefvekfmqgqvpygswykhvkswwekg
ksprvlflfyedlkedirkeviklihflerkpseelvdriihhtsfqemknnpstnyttl
pdeimnqklspfmrkgitgdwknhftvalnekfdkhyeqqmkestlkfrt
SCOPe Domain Coordinates for d1g3ma_:
Click to download the PDB-style file with coordinates for d1g3ma_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1g3ma_:
- d1g3ma_ first appeared in SCOP 1.65
- d1g3ma_ appears in SCOPe 2.07
View in 3D
