Lineage for d1fyva_ (1fyv A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1356042Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1356607Superfamily c.23.2: Toll/Interleukin receptor TIR domain [52200] (2 families) (S)
  5. 1356608Family c.23.2.1: Toll/Interleukin receptor TIR domain [52201] (3 proteins)
    automatically mapped to Pfam PF01582
  6. 1356609Protein Toll-like receptor 1, TLR1 [52202] (1 species)
  7. 1356610Species Human (Homo sapiens) [TaxId:9606] [52203] (1 PDB entry)
  8. 1356611Domain d1fyva_: 1fyv A: [31127]

Details for d1fyva_

PDB Entry: 1fyv (more details), 2.9 Å

PDB Description: crystal structure of the tir domain of human tlr1
PDB Compounds: (A:) toll-like receptor 1

SCOPe Domain Sequences for d1fyva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fyva_ c.23.2.1 (A:) Toll-like receptor 1, TLR1 {Human (Homo sapiens) [TaxId: 9606]}
nipleelqrnlqfhafisysghdsfwvknellpnlekegmqiclhernfvpgksivenii
tcieksyksifvlspnfvqsewchyelyfahhnlfhegsnslilillepipqysipssyh
klkslmarrtylewpkekskrglfwanlraainiklteqak

SCOPe Domain Coordinates for d1fyva_:

Click to download the PDB-style file with coordinates for d1fyva_.
(The format of our PDB-style files is described here.)

Timeline for d1fyva_: