Lineage for d1fxta_ (1fxt A:)
- Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds) 
Fold d.20: UBC-like [54494] (1 superfamily)
alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2Superfamily d.20.1: UBC-like [54495] (5 families) 
Family d.20.1.1: UBC-related [54496] (7 proteins) Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species) 
Species Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId:4932] [69685] (3 PDB entries)
Uniprot P21734
Domain d1fxta_: 1fxt A: [65055]
Other proteins in same PDB: d1fxtb_
Details for d1fxta_
PDB Entry: 1fxt (more details)
PDB Description: structure of a conjugating enzyme-ubiquitin thiolester complex
PDB Compounds: (A:) ubiquitin-conjugating enzyme e2-24 kdaSCOPe Domain Sequences for d1fxta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fxta_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId: 4932]}
srakrimkeiqavkddpaahitlefvsesdihhlkgtflgppgtpyeggkfvvdievpme
ypfkppkmqfdtkvyhpnissvtgaicldilknawspvitlksalislqallqspepndp
qdaevaqhylrdresfnktaalwtrlyas
SCOPe Domain Coordinates for d1fxta_:
Click to download the PDB-style file with coordinates for d1fxta_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fxta_:
- d1fxta_ first appeared in SCOP 1.59
- d1fxta_ appears in SCOPe 2.05
- d1fxta_ appears in SCOPe 2.07
- d1fxta_ appears in the current release, SCOPe 2.08
View in 3D
