Lineage for d1fxla2 (1fxl A:119-203)
- Root: SCOPe 2.03
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) 
Family d.58.7.1: Canonical RBD [54929] (68 proteins) 
Protein Hu antigen D (Hud) [54942] (1 species) Species Human (Homo sapiens) [TaxId:9606] [54943] (2 PDB entries) 
Domain d1fxla2: 1fxl A:119-203 [39184]
protein/RNA complex
Details for d1fxla2
PDB Entry: 1fxl (more details), 1.8 Å
PDB Description: crystal structure of hud and au-rich element of the c-fos rna
PDB Compounds: (A:) paraneoplastic encephalomyelitis antigen hudSCOPe Domain Sequences for d1fxla2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]}
sasirdanlyvsglpktmtqkeleqlfsqygriitsrilvdqvtgvsrgvgfirfdkrie
aeeaikglngqkpsgatepitvkfa
SCOPe Domain Coordinates for d1fxla2:
Click to download the PDB-style file with coordinates for d1fxla2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fxla2:
- d1fxla2 first appeared (with stable ids) in SCOP 1.55
- d1fxla2 appears in SCOPe 2.02
- d1fxla2 appears in SCOPe 2.04
- d1fxla2 appears in the current release, SCOPe 2.08
View in 3D
