Lineage for d1fsfa_ (1fsf A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2169412Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2169413Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2169414Family c.124.1.1: NagB-like [52513] (3 proteins)
    share a common phosphate-binding site with the RpiA family
  6. 2169419Protein Glucosamine 6-phosphate deaminase/isomerase NagB [52514] (2 species)
  7. 2169420Species Escherichia coli [TaxId:562] [52515] (10 PDB entries)
  8. 2169421Domain d1fsfa_: 1fsf A: [65047]

Details for d1fsfa_

PDB Entry: 1fsf (more details), 1.9 Å

PDB Description: glucosamine-6-phosphate deaminase from e.coli, t conformer, at 1.9a resolution
PDB Compounds: (A:) glucosamine-6-phosphate deaminase

SCOPe Domain Sequences for d1fsfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fsfa_ c.124.1.1 (A:) Glucosamine 6-phosphate deaminase/isomerase NagB {Escherichia coli [TaxId: 562]}
mrliplttaeqvgkwaarhivnrinafkptadrpfvlglptggtpmttykalvemhkagq
vsfkhvvtfnmdeyvglpkehpesyysfmhrnffdhvdipaeninllngnapdidaecrq
yeekirsygkihlfmggvgndghiafnepasslasrtriktlthdtrvansrffdndvnq
vpkyaltvgvgtlldaeevmilvlgsqkalalqaavegcvnhmwtisclqlhpkaimvcd
epstmelkvktlryfneleaenikgl

SCOPe Domain Coordinates for d1fsfa_:

Click to download the PDB-style file with coordinates for d1fsfa_.
(The format of our PDB-style files is described here.)

Timeline for d1fsfa_: