Lineage for d1fr1a_ (1fr1 A:)
- Root: SCOPe 2.04
Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds) Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
contains a cluster of helices and an alpha+beta sandwichSuperfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) 
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) 
Protein AMPC beta-Lactamase, class C [56618] (3 species)
contains small alpha+beta subdomain inserted in the common fold
Species Citrobacter freundii [TaxId:546] [56619] (3 PDB entries) 
Domain d1fr1a_: 1fr1 A: [42734]
Details for d1fr1a_
PDB Entry: 1fr1 (more details), 2 Å
PDB Description: refined crystal structure of beta-lactamase from citrobacter freundii indicates a mechanism for beta-lactam hydrolysis
PDB Compounds: (A:) Beta-lactamaseSCOPe Domain Sequences for d1fr1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fr1a_ e.3.1.1 (A:) AMPC beta-Lactamase, class C {Citrobacter freundii [TaxId: 546]}
aakteqqiadivnrtitplmqeqaipgmavaiiyqgkpyyftwgkadiannrpvtqqtlf
elgsvsktfngvlggdaiargeiklsdpvtqywpeltgkqwqgisllhlatytagglplq
vpddvtdkaallrfyqnwqpqwapgakrlyanssiglfgalavkpsgmsyeeamskrvlh
plklahtwitvpqseqkdyawgyregkpvhvspgqldaeaygvkssvidmtrwvqanmda
sqvqektlqqgielaqsrywrigdmyqglgwemlnwpvkadsiisgsdskvalaalpave
vnppapavkaswvhktgstggfgsyvafvpeknlgivmlanksypnpvrveaawrilekl
q
SCOPe Domain Coordinates for d1fr1a_:
Click to download the PDB-style file with coordinates for d1fr1a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fr1a_:
- d1fr1a_ first appeared (with stable ids) in SCOP 1.55
- d1fr1a_ appears in SCOPe 2.03
- d1fr1a_ appears in SCOPe 2.05
- d1fr1a_ appears in the current release, SCOPe 2.08
View in 3D
