Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Immunoglobulin heavy chain epsilon constant domain 4, CH4-epsilon [88598] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [88599] (4 PDB entries) |
Domain d1fp5a2: 1fp5 A:439-543 [21531] Other proteins in same PDB: d1fp5a1 |
PDB Entry: 1fp5 (more details), 2.3 Å
SCOPe Domain Sequences for d1fp5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fp5a2 b.1.1.2 (A:439-543) Immunoglobulin heavy chain epsilon constant domain 4, CH4-epsilon {Human (Homo sapiens) [TaxId: 9606]} praapevyafatpewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprkt kgsgffvfsrlevtraeweqkdeficravheaaspsqtvqravsv
Timeline for d1fp5a2: