Lineage for d1fnfa1 (1fnf A:1142-1235)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2761682Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2761880Protein Fibronectin, different Fn3 modules [49270] (3 species)
  7. 2761883Species Human (Homo sapiens) [TaxId:9606] [49271] (9 PDB entries)
  8. 2761885Domain d1fnfa1: 1fnf A:1142-1235 [21972]
    repeats 7 through 10

Details for d1fnfa1

PDB Entry: 1fnf (more details), 2 Å

PDB Description: fragment of human fibronectin encompassing type-iii repeats 7 through 10
PDB Compounds: (A:) Fibronectin

SCOPe Domain Sequences for d1fnfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}
plspptnlhleanpdtgvltvswersttpditgyritttptngqqgnsleevvhadqssc
tfdnlspgleynvsvytvkddkesvpisdtiipa

SCOPe Domain Coordinates for d1fnfa1:

Click to download the PDB-style file with coordinates for d1fnfa1.
(The format of our PDB-style files is described here.)

Timeline for d1fnfa1: