Lineage for d1fmja_ (1fmj A:)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) 
division into families based on beta-sheet topologies
Family c.37.1.5: PAPS sulfotransferase [52575] (15 proteins)
Pfam PF00685
similar to the nucleotide/nucleoside kinases but transfer sulphate group
Protein Retinol dehydratase [64015] (1 species) Species Fall armyworm (Spodoptera frugiperda) [TaxId:7108] [64016] (2 PDB entries) 
Domain d1fmja_: 1fmj A: [59879]
complexed with a3p, ca, hg, rtl
Details for d1fmja_
PDB Entry: 1fmj (more details), 2 Å
PDB Description: crystal structure of mercury derivative of retinol dehydratase in a complex with retinol and pap
PDB Compounds: (A:) retinol dehydrataseSCOPe Domain Sequences for d1fmja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fmja_ c.37.1.5 (A:) Retinol dehydratase {Fall armyworm (Spodoptera frugiperda) [TaxId: 7108]}
pfpyefrelnpeedklvkanlgafpttyvklgpkgymvyrpylkdaaniynmplrptdvf
vasyqrsgttmtqelvwliendlnfeaaktymslryiyldgfmiydpekqeeyndilpnp
enldmerylglleyssrpgssllaavpptekrfvkthlplslmppnmldtvkmvylardp
rdvavssfhharllyllnkqsnfkdfwemfhrglytltpyfehvkeawakrhdpnmlflf
yedylkdlpgciariadflgkklseeqiqrlcehlnfekfknngavnmedyreigiladg
ehfirkgkagcwrdyfdeemtkqaekwikdnlkdtdlrypnm
SCOPe Domain Coordinates for d1fmja_:
Click to download the PDB-style file with coordinates for d1fmja_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fmja_:
- d1fmja_ first appeared in SCOP 1.57
- d1fmja_ appears in SCOPe 2.06
- d1fmja_ appears in the current release, SCOPe 2.08
View in 3D
