Lineage for d1fmca_ (1fmc A:)
- Root: SCOPe 2.04
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similarSuperfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) 
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
also known as short-chain dehydrogenases and SDR family
parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
Protein 7-alpha-hydroxysteroid dehydrogenase [51774] (1 species) Species Escherichia coli [TaxId:562] [51775] (3 PDB entries) 
Domain d1fmca_: 1fmc A: [29856]
complexed with cho, nai
Details for d1fmca_
PDB Entry: 1fmc (more details), 1.8 Å
PDB Description: 7-alpha-hydroxysteroid dehydrogenase complex with nadh and 7-oxo glycochenodeoxycholic acid
PDB Compounds: (A:) 7 alpha-hydroxysteroid dehydrogenaseSCOPe Domain Sequences for d1fmca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]}
mfnsdnlrldgkcaiitgagagigkeiaitfatagasvvvsdinadaanhvvdeiqqlgg
qafacrcditseqelsaladfaisklgkvdilvnnaggggpkpfdmpmadfrrayelnvf
sffhlsqlvapemekngggviltitsmaaenkninmtsyasskaaashlvrnmafdlgek
nirvngiapgailtdalksvitpeieqkmlqhtpirrlgqpqdianaalflcspaaswvs
gqiltvsgggvqeln
SCOPe Domain Coordinates for d1fmca_:
Click to download the PDB-style file with coordinates for d1fmca_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fmca_:
- d1fmca_ first appeared (with stable ids) in SCOP 1.55
- d1fmca_ appears in SCOPe 2.03
- d1fmca_ appears in SCOPe 2.05
- d1fmca_ appears in the current release, SCOPe 2.08
View in 3D
