Lineage for d1fjgc2 (1fjg C:107-207)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 860387Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
    alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143
  4. 860388Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) (S)
  5. 860389Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)
  6. 860390Protein Ribosomal protein S3 C-terminal domain [54823] (2 species)
  7. 860416Species Thermus thermophilus [TaxId:274] [54824] (36 PDB entries)
    Uniprot P80372
  8. 860418Domain d1fjgc2: 1fjg C:107-207 [38839]
    Other proteins in same PDB: d1fjgb_, d1fjgc1, d1fjgd_, d1fjge1, d1fjge2, d1fjgf_, d1fjgg_, d1fjgh_, d1fjgi_, d1fjgj_, d1fjgk_, d1fjgl_, d1fjgm_, d1fjgn_, d1fjgo_, d1fjgp_, d1fjgq_, d1fjgr_, d1fjgs_, d1fjgt_, d1fjgv_
    complexed with mg, par, scm, sry, zn

Details for d1fjgc2

PDB Entry: 1fjg (more details), 3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin
PDB Compounds: (C:) 30S ribosomal protein S3

SCOP Domain Sequences for d1fjgc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fjgc2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus [TaxId: 274]}
qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte
waaqgrvplhtlranidygfalarttygvlgvkayiflgev

SCOP Domain Coordinates for d1fjgc2:

Click to download the PDB-style file with coordinates for d1fjgc2.
(The format of our PDB-style files is described here.)

Timeline for d1fjgc2: