Lineage for d1fjeb1 (1fje B:1-91)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2195050Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2195051Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 2195210Protein Nucleolin [54952] (2 species)
  7. 2195211Species Golden hamster (Mesocricetus auratus) [TaxId:10036] [54953] (4 PDB entries)
  8. 2195212Domain d1fjeb1: 1fje B:1-91 [39210]
    protein/RNA complex

Details for d1fjeb1

PDB Entry: 1fje (more details)

PDB Description: solution structure of nucleolin rbd12 in complex with snre rna
PDB Compounds: (B:) nucleolin rbd12

SCOPe Domain Sequences for d1fjeb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]}
gshmvegsesttpfnlfignlnpnksvaelkvaiselfakndlavvdvrtgtnrkfgyvd
fesaedlekaleltglkvfgneiklekpkgr

SCOPe Domain Coordinates for d1fjeb1:

Click to download the PDB-style file with coordinates for d1fjeb1.
(The format of our PDB-style files is described here.)

Timeline for d1fjeb1: